missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SAT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-37947
This item is not returnable.
View return policy
Description
SAT1 Polyclonal specifically detects SAT1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| SAT1 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| P21673 | |
| SAT1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLV | |
| 0.1 mL | |
| Cancer, Cell Biology, Hypoxia, Mitochondrial Markers | |
| 6303 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DC21, diamine acetyltransferase 1, diamine N-acetyltransferase 1, EC 2.3.1.57, KFSD, Polyamine N-acetyltransferase 1, Putrescine acetyltransferase, SAT, Spermidine/spermine N(1)-acetyltransferase 1, spermidine/spermine N1-acetyltransferase, spermidine/spermine N1-acetyltransferase 1, spermidine/spermine N1-acetyltransferase alpha, SSAT-1, SSATKFSDX | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction