missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SASH3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£385.00
Specifications
| Antigen | SASH3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SASH3 Polyclonal specifically detects SASH3 in Human samples. It is validated for Western Blot.Specifications
| SASH3 | |
| Polyclonal | |
| Rabbit | |
| Q8K352 | |
| 54440 | |
| Synthetic peptides corresponding to CXORF9 The peptide sequence was selected from the N terminal of CXORF9. Peptide sequence KPSSPVVSEKEFNLDDNIPEDDSGVPTPEDAGKSGKKLGKKWRAVISRTM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CXorf9, HACS2, SAM and SH3 domain containing 3, SAM and SH3 domain-containing protein 3, SH3 protein expressed in lymphocytes homolog, SH3D6C, SLYchromosome X open reading frame 9,753P9 | |
| SASH3 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title