missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SARS Nucleocapsid Protein Antibody (AP201054), DyLight 755, Novus Biologicals™
Shop All Bio Techne ProductsDescription
SARS Nucleocapsid Protein Monoclonal antibody specifically detects SARS Nucleocapsid Protein in SARS-CoV, SARS-CoV-2 samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoassay, Direct ELISA
Specifications
Specifications
| Antigen | SARS Nucleocapsid Protein |
| Applications | Western Blot, ELISA, Immunocytochemistry, Immunoassay, Direct ELISA |
| Classification | Monoclonal |
| Clone | AP201054 |
| Conjugate | DyLight 755 |
| Dilution | Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoassay, Direct ELISA |
| Formulation | 50mM Sodium Borate |
| Gene Alias | N, N protein, N structural protein, NC, Nucleocapsid protein, Nucleoprotein, Protein N, SARS coronavirus N protein, SARS coronavirus nucleocapsid protein, SARS CoV, SARS CoV N protein, SARS CoV nucleocapsid protein, SARS N protein, SARS Nucleoprotein, SARSCoV, SARSCoV N protein, SARSCoV nucleocapsid protein, Severe acute respiratory syndrome |
| Host Species | Mouse |
| Immunogen | The antibody was developed by immunizing mice with a with a protein fragment corresponding to amino acids 1-49 (C-MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNN) from the N (SARS Nucleocapsid) for the Human SARS coronavirus (Genbank accession no. NP_828858.1) |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?