missing translation for 'onlineSavingsMsg'
Learn More

SARS Nucleocapsid Protein Antibody (AP201054), Alexa Fluor™ 700, Novus Biologicals™

Product Code. 18429208 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18429208 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18429208 Supplier Novus Biologicals Supplier No. NBP290967AF700

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

SARS Nucleocapsid Protein Monoclonal antibody specifically detects SARS Nucleocapsid Protein in SARS-CoV, SARS-CoV-2 samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoassay, Direct ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen SARS Nucleocapsid Protein
Applications Western Blot, ELISA, Immunocytochemistry, Immunoassay, Direct ELISA
Classification Monoclonal
Clone AP201054
Conjugate Alexa Fluor 700
Dilution Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoassay, Direct ELISA
Formulation 50mM Sodium Borate
Gene Alias N, N protein, N structural protein, NC, Nucleocapsid protein, Nucleoprotein, Protein N, SARS coronavirus N protein, SARS coronavirus nucleocapsid protein, SARS CoV, SARS CoV N protein, SARS CoV nucleocapsid protein, SARS N protein, SARS Nucleoprotein, SARSCoV, SARSCoV N protein, SARSCoV nucleocapsid protein, Severe acute respiratory syndrome
Host Species Mouse
Immunogen The antibody was developed by immunizing mice with a with a protein fragment corresponding to amino acids 1-49 (C-MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNN) from the N (SARS Nucleocapsid) for the Human SARS coronavirus (Genbank accession no. NP_828858.1)
Purification Method Protein G purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Infections (Virus Bacteria and Parasites)
Primary or Secondary Primary
Gene ID (Entrez) 1489678
Target Species SARS-CoV, SARS-CoV-2
Content And Storage Store at 4C in the dark.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.