missing translation for 'onlineSavingsMsg'
Learn More

SARS-CoV-2 ORF9b Rabbit anti-SARS-CoV-2, Polyclonal, Novus Biologicals™

Product Code. 18395162 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18395162 100 μg 100µL
18304945 20 μg 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18395162 Supplier Novus Biologicals Supplier No. NBP315988100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

SARS-CoV-2 ORF9b Polyclonal antibody specifically detects SARS-CoV-2 ORF9b in SARS-CoV-2 samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen SARS-CoV-2 ORF9b
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000
Formulation PBS, 50% glycerol, pH7.3
Gene Alias Accessory protein 9b, ORF9b, ORF-9b, Protein 9b
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of coronavirus ORF9b (P0DTD2). MDPKISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Infections (Virus Bacteria and Parasites)
Primary or Secondary Primary
Target Species SARS-CoV-2
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.