missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18360124

SARS-CoV-2 ORF8 Antibody - Azide and BSA Free, Novus Biologicals™

Código de producto. 18360124 Tienda Bio Techne Productos
Change view
Click to view available options
Quantity:
0.05 mg
Tamaño de la unidad:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Quantity unitSize
18360124 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18360124 Proveedor Novus Biologicals N.º de proveedor NBP307972

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

SARS-CoV-2 ORF8 Polyclonal specifically detects SARS-CoV-2 ORF8 in SARS-CoV-2 samples. It is validated for Western Blot, ELISA, SDS-Page.
TRUSTED_SUSTAINABILITY

Especificaciones

Antigen SARS-CoV-2 ORF8
Applications Western Blot, ELISA
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot, ELISA 1:4000-1:8000, SDS-Page
Formulation PBS, pH 7.4, 50% glycerol.
Gene Alias 2019-nCoV ORF8, 2019-nCoV ORF8 Protein, COVID-19 Non-structural protein 8, COVID-19 ns8, COVID-19 ORF8, Human coronavirus ORF8 Protein, Non-structural protein 8, ns8, ORF8 protein, SARS-CoV-2, SARS-CoV-2 Non-structural protein 8, SARS-CoV-2 ns8, SARSCoV2 ORF8 Protein, SARS-CoV-2 ORF8 Protein, Severe Acute Respiratory Syndrome Coronavirus 2 ORF8 Protein
Host Species Rabbit
Immunogen Sequence: MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
Purification Method Antigen Affinity-purified
Quantity 0.05 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 43740577
Target Species SARS-CoV-2
Content And Storage Store at 4°C short term. Store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.