missing translation for 'onlineSavingsMsg'
Learn More

SARS-CoV-2 ORF8 Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. 18360124 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18360124 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18360124 Supplier Novus Biologicals Supplier No. NBP307972

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

SARS-CoV-2 ORF8 Polyclonal specifically detects SARS-CoV-2 ORF8 in SARS-CoV-2 samples. It is validated for Western Blot, ELISA, SDS-Page.
TRUSTED_SUSTAINABILITY

Specifications

Antigen SARS-CoV-2 ORF8
Applications Western Blot, ELISA
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot, ELISA 1:4000-1:8000, SDS-Page
Formulation PBS, pH 7.4, 50% glycerol.
Gene Alias 2019-nCoV ORF8, 2019-nCoV ORF8 Protein, COVID-19 Non-structural protein 8, COVID-19 ns8, COVID-19 ORF8, Human coronavirus ORF8 Protein, Non-structural protein 8, ns8, ORF8 protein, SARS-CoV-2, SARS-CoV-2 Non-structural protein 8, SARS-CoV-2 ns8, SARSCoV2 ORF8 Protein, SARS-CoV-2 ORF8 Protein, Severe Acute Respiratory Syndrome Coronavirus 2 ORF8 Protein
Host Species Rabbit
Immunogen Sequence: MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
Purification Method Antigen Affinity-purified
Quantity 0.05 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 43740577
Target Species SARS-CoV-2
Content And Storage Store at 4°C short term. Store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.