missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SARS-CoV-2 ORF8 Polyclonal specifically detects SARS-CoV-2 ORF8 in SARS-CoV-2 samples. It is validated for Western Blot, ELISA, SDS-Page.
Specifications
Specifications
| Antigen | SARS-CoV-2 ORF8 |
| Applications | Western Blot, ELISA |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot, ELISA 1:4000-1:8000, SDS-Page |
| Formulation | PBS, pH 7.4, 50% glycerol. |
| Gene Alias | 2019-nCoV ORF8, 2019-nCoV ORF8 Protein, COVID-19 Non-structural protein 8, COVID-19 ns8, COVID-19 ORF8, Human coronavirus ORF8 Protein, Non-structural protein 8, ns8, ORF8 protein, SARS-CoV-2, SARS-CoV-2 Non-structural protein 8, SARS-CoV-2 ns8, SARSCoV2 ORF8 Protein, SARS-CoV-2 ORF8 Protein, Severe Acute Respiratory Syndrome Coronavirus 2 ORF8 Protein |
| Host Species | Rabbit |
| Immunogen | Sequence: MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI |
| Purification Method | Antigen Affinity-purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?