missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18353365

SARS-CoV-2 ORF7a Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. 18353365 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18353365 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18353365 Supplier Novus Biologicals Supplier No. NBP307971

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

SARS-CoV-2 ORF7a Polyclonal specifically detects SARS-CoV-2 ORF7a in SARS-CoV-2 samples. It is validated for ELISA.
TRUSTED_SUSTAINABILITY

Specifications

Antigen SARS-CoV-2 ORF7a
Applications ELISA
Classification Polyclonal
Conjugate Unconjugated
Dilution ELISA 1:4000-1:8000
Formulation PBS, pH 7.4, 50% glycerol.
Gene Alias 2019-nCoV ORF7a, 2019-nCoV ORF7a Protein, Accessory Protein 7a, COVID-19 Accessory Protein 7a, COVID-19 ORF7a, COVID-19 Protein U122, COVID-19 Protein X4, Human coronavirus ORF7a Protein, ORF7a Protein, Protein U122, Protein X4, SARS-CoV-2 Accessory Protein 7a, SARS-CoV-2 Protein U122, SARS-CoV-2 Protein X4
Host Species Rabbit
Immunogen Sequence: MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE
Purification Method Antigen Affinity-purified
Quantity 0.05 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 43740573
Target Species SARS-CoV-2
Content And Storage Store at 4°C short term. Store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.