missing translation for 'onlineSavingsMsg'
Learn More

SARS-CoV-2 nsp4 Rabbit anti-SARS-CoV-2, Polyclonal, Novus Biologicals™

Product Code. 18373864 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18373864 20 μg 20µL
18093484 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18373864 Supplier Novus Biologicals Supplier No. NBP31599120UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

SARS-CoV-2 nsp4 Polyclonal antibody specifically detects SARS-CoV-2 nsp4 in SARS-CoV-2 samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen SARS-CoV-2 nsp4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000
Formulation PBS, 50% glycerol, pH7.3
Gene Alias Corona_NSP4_C, Coronavirus nonstructural protein 4 C-terminus, Non-structural protein 4, nsp4
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 399-499 of coronavirus NSP4 (YP_009725300.1). KRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVL
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Infections (Virus Bacteria and Parasites)
Primary or Secondary Primary
Gene ID (Entrez) 43740578
Target Species SARS-CoV-2
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.