missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SAPS3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £471.00
Specifications
| Antigen | SAPS3 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18449761
|
Novus Biologicals
NBP2-34049-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18024304
|
Novus Biologicals
NBP2-34049 |
0.1 mL |
£471.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SAPS3 Polyclonal specifically detects SAPS3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| SAPS3 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| C11orf23SAPLa, chromosome 11 open reading frame 23, DKFZp781E17107, DKFZp781E2374, DKFZp781O2362, FLJ11058, FLJ43065, KIAA1558MGC125711, PP6R3MGC125712, protein phosphatase 6, regulatory subunit 3, SAPLSAP190, SAPS domain family member 3, SAPS3SAPS domain family, member 3, serine/threonine-protein phosphatase 6 regulatory subunit 3, Sporulation-induced transcript 4-associated protein SAPL | |
| PPP6R3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q5H9R7 | |
| 55291 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ADQDDIGNVSFDRVSDINFTLNTNESGNIALFEACCKERIQQFDDGGSDEEDIWEEKHIAFTPESQRRSSS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title