SAP30L Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17535-25UL

Product Code. 18345995

Description

SAP30L Polyclonal antibody specifically detects SAP30L in Human samples. It is validated for Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: SAP30L
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: DKFZp667L2214, FLJ11526, FLJ36497, HCV non-structural protein 4A-transactivated protein 2, histone deacetylase complex subunit SAP30L, NS4ATP2FLJ23595, SAP30-like, Sin3 corepressor complex subunit SAP30L, Sin3A associated protein p30-like, Sin3-associated protein p30-like
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MNGFSTEEDSREGPPAAPAAAAPGYGQSCCLIE
• Quantity: 25 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79685
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG