missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SAP30L Rabbit anti-Human, Polyclonal, Novus Biologicals™

SAP30L Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18345995 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18345995 25 μg 25µL
18345896 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18345995 Supplier Novus Biologicals Supplier No. NBP31753525UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

SAP30L Polyclonal antibody specifically detects SAP30L in Human samples. It is validated for Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen SAP30L
Applications Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias DKFZp667L2214, FLJ11526, FLJ36497, HCV non-structural protein 4A-transactivated protein 2, histone deacetylase complex subunit SAP30L, NS4ATP2FLJ23595, SAP30-like, Sin3 corepressor complex subunit SAP30L, Sin3A associated protein p30-like, Sin3-associated protein p30-like
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: MNGFSTEEDSREGPPAAPAAAAPGYGQSCCLIE
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 79685
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.