missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SAP30 Antibody (1D3), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00008819-M03
This item is not returnable.
View return policy
Description
SAP30 Monoclonal antibody specifically detects SAP30 in Human samples. It is validated for Western Blot, ELISA
Specifications
| SAP30 | |
| Monoclonal | |
| Unconjugated | |
| NP_003855 | |
| Mouse | |
| IgG purified | |
| RUO | |
| 8819 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
| Western Blot, ELISA | |
| 1D3 | |
| In 1x PBS, pH 7.4 | |
| 30 kDa Sin3-associated polypeptide, histone deacetylase complex subunit SAP30, Sin3 corepressor complex subunit SAP30, Sin3A-associated protein, 30kDa, Sin3-associated polypeptide p30, sin3-associated polypeptide, 30 kDa, Sin3-associated polypeptide, 30kDa | |
| SAP30 (NP_003855, 131 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYFIYSVKNDKNKSDLKVDSGV | |
| 0.1 mg | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction