SALL1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17307-100UL

Product Code. 18344624

Description

SALL1 Polyclonal antibody specifically detects SALL1 in Human samples. It is validated for Immunofluorescence

Specifications

• Antigen: SALL1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: HSAL1, sal (Drosophila)-like 1, Sal-1, SAL1, sal-like 1 (Drosophila), sal-like protein 1, Spalt-like transcription factor 1, Zinc finger protein 794, Zinc finger protein SALL1, Zinc finger protein Spalt-1, ZNF794TBS
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ISESTSSMQALSPSNSTQEFHKSPSIEEKPQRAVPSEFANGLSPTPVNGGALDLTSSHAEK
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6299
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG