missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Salivary Amylase Alpha Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | Salivary Amylase Alpha |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18681846
|
Novus Biologicals
NBP2-46735-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18649945
|
Novus Biologicals
NBP2-46735 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Salivary Amylase Alpha Polyclonal antibody specifically detects Salivary Amylase Alpha in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Salivary Amylase Alpha | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| Q5T085 | |
| 276 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2), 40% Glycerol | |
| 1,4-alpha-D-glucan glucanohydrolase 1, alpha-amylase 1, AMY1, AMY1B, AMY1C, amylase, alpha 1A (salivary), amylase, alpha 1A, salivary, amylase, salivary, alpha-1A, EC 3.2.1.1, glycogenase, Salivary alpha-amylase, salivary amylase alpha 1A | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: GNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRL | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title