missing translation for 'onlineSavingsMsg'
Learn More

Salivary Amylase Alpha Antibody (2D4), Novus Biologicals™

Product Code. 18377827 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18377827 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18377827 Supplier Novus Biologicals Supplier No. H00000276M04

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

Salivary Amylase Alpha Monoclonal antibody specifically detects Salivary Amylase Alpha in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Salivary Amylase Alpha
Applications Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 2D4
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunohistochemistry 1:10 to 1:500, Immunohistochemistry-Paraffin 1:10 to 1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_001008222
Gene Alias 1,4-alpha-D-glucan glucanohydrolase 1, alpha-amylase 1, AMY1, AMY1B, AMY1C, amylase, alpha 1A (salivary), amylase, alpha 1A, salivary, amylase, salivary, alpha-1A, EC 3.2.1.1, glycogenase, Salivary alpha-amylase, salivary amylase alpha 1A
Host Species Mouse
Immunogen AMY1A (NP_001008222, 172 a.a. ~ 245 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFI
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 276
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.