missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PORCN Antibody, R&D Systems™

PORCN Antibody, R&D Systems™

Code produit 18621509 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantity:
25 μL
100 μL
Conditionnement:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantity Conditionnement
18621509 25 μL 25µL
18285372 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18621509 Fournisseur Novus Biologicals Code fournisseur NBP25850425ul
 Restricted Item
Estimated Shipment: 01-12-2026
Ajouter au panier
Ajouter au panier

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

PORCN Polyclonal specifically detects PORCN in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin).
TRUSTED_SUSTAINABILITY

Spécification

Antigen PORCN
Applications Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Gene Alias 2410004O13Rik, DHOF, EC 2.3.1.-, FODH, MG61PPNprobable protein-cysteine N-palmitoyltransferase porcupine, por, PORCMGC29687, porcupine homolog (Drosophila), Protein MG61
Gene Symbols PORCN
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AVSFHFSNYFVGFLSEATATLAGAGFTEEKDHLEWDLTVSKPLNVELPRSMVEVVTSWNLPMSYWLNNYVFKNAL
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 64840
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Product Type Antibody
Isotype IgG
Product Line Novus
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.