missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ SAFB Polyclonal Antibody

Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA579952
This item is not returnable.
View return policy
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HELA whole cell, MCF-7 whole cell.
This gene encodes a DNA-binding protein which has high specificity for scaffold or matrix attachment region DNA elements (S/MAR DNA). This protein is thought to be involved in attaching the base of chromatin loops to the nuclear matrix but there is conflicting evidence as to whether this protein is a component of chromatin or a nuclear matrix protein. Scaffold attachment factors are a specific subset of nuclear matrix proteins (NMP) that specifically bind to S/MAR. The encoded protein is thought to serve as a molecular base to assemble a 'transcriptosome complex' in the vicinity of actively transcribed genes. It is involved in the regulation of heat shock protein 27 transcription, can act as an estrogen receptor co-repressor and is a candidate for breast tumorigenesis. This gene is arranged head-to-head with a similar gene whose product has the same functions. Multiple transcript variants encoding different isoforms have been found for this gene.
Specifications
| SAFB | |
| Polyclonal | |
| Unconjugated | |
| SAFB | |
| 3110021E02Rik; 5330423C17Rik; AU018122; D18386; DKFZp779C1727; E130307D12; glutathione S-transferase fusion protein; HAP; heat-shock protein (HSP27) estrogen response element and TATA box-binding protein; HET; Hsp27 ERE-TATA binding protein; HSP27 ERE-TATA-binding protein; HSP27 estrogen response element-TATA box-binding protein; SAB-B1; Safb; SAF-B; Safb1; SAF-B1; scaffold attachment factor B; scaffold attachment factor B1 | |
| Rabbit | |
| Antigen affinity chromatography | |
| RUO | |
| 6294 | |
| -20°C | |
| Lyophilized |
| Western Blot | |
| 500 μg/mL | |
| PBS with 5mg BSA and 0.05mg sodium azide | |
| Q15424 | |
| SAFB | |
| A synthetic peptide corresponding to a sequence at the C-terminus of human SAFB (715-754aa DLDRRDDAYWPEAKRAALDERYHSDFNRQDRFHDFDHRDR). | |
| 100 μg | |
| Primary | |
| Human | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction