missing translation for 'onlineSavingsMsg'
Learn More

SAFB Antibody (5A11), Novus Biologicals™

Product Code. 18391519 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18391519 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18391519 Supplier Novus Biologicals Supplier No. H00006294M04

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

SAFB Monoclonal antibody specifically detects SAFB in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen SAFB
Applications Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 5A11
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_002958
Gene Alias glutathione S-transferase fusion protein, HAP, heat-shock protein (HSP27) estrogen response element and TATA box-bindingprotein, HETDKFZp779C1727, Hsp27 ERE-TATA binding protein, HSP27 ERE-TATA-binding protein, HSP27 estrogen response element-TATA box-binding protein, SAF-B, SAF-B1, SAFB1SAB-B1, scaffold attachment factor B, scaffold attachment factor B1
Host Species Mouse
Immunogen SAFB (NP_002958, 111 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DGQEDVETSLENLQDIDIMDISVLDEAEIDNGSVADCVEDDDADNLQESLSDSRELVEGEMKELPEQLQEHAIEDKETINNLDTSSSDFT
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline DNA Repair
Primary or Secondary Primary
Gene ID (Entrez) 6294
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.