missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SAAL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | SAAL1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SAAL1 Polyclonal specifically detects SAAL1 in Human samples. It is validated for Western Blot.Specifications
| SAAL1 | |
| Polyclonal | |
| Rabbit | |
| Q96ER3 | |
| 113174 | |
| Synthetic peptides corresponding to SAAL1 (serum amyloid A-like 1) The peptide sequence was selected from the N terminal of SAAL1. Peptide sequence MDRNPSPPPPGRDKEEEEEVAGGDCIGSTVYSKHWLFGVLSGLIQIVSPE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ41463, protein SAAL1, serum amyloid A-like 1 | |
| SAAL1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title