S5a/Angiocidin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-90821

Product Code. 18291846

Description

S5a/Angiocidin Polyclonal specifically detects S5a/Angiocidin in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Proteasome 19S S5A
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: P55036
• Gene Symbols: PSMD4
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGI
• Quantity: 0.1 mL
• Research Discipline: Neuroscience, Ubiquitin Proteasome Pathway
• Gene ID (Entrez): 5710
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 26S proteasome non-ATPase regulatory subunit 4, 26S proteasome regulatory subunit S5A, AF-1,26S protease subunit S5a, AFMCB1, angiocidin, Antisecretory factor 1, ASF, multiubiquitin chain binding protein, Multiubiquitin chain-binding protein, proteasome (prosome, macropain) 26S subunit, non-ATPase, 4, pUB-R5,26S proteasome regulatory subunit RPN10, Rpn10, RPN10 homolog, S5A, S5a/antisecretory factor protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only