missing translation for 'onlineSavingsMsg'
Learn More
Learn More
S1P4/EDG-6 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£155.00 - £364.00
Specifications
| Antigen | S1P4/EDG-6 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
S1P4/EDG-6 Polyclonal antibody specifically detects S1P4/EDG-6 in Human samples. It is validated for Western BlotSpecifications
| S1P4/EDG-6 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cellular Markers, GPCR, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 8698 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| EDG6S1P receptor Edg-6, Endothelial differentiation G-protein coupled receptor 6, endothelial differentiation, G-protein-coupled receptor 6, endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor6,endothelial differentiation, G protein coupled receptor 6, S1P receptor 4, S1P4LPC1, SLP4, sphingosine 1-phosphate receptor 4, Sphingosine 1-phosphate receptor Edg-6, sphingosine-1-phosphate receptor 4 | |
| A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human S1PR4 (NP_003766.1). SAVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDSFRGSRSLSFRMREPLSSISSVRSI | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title