missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
S1P2/EDG-5/S1PR2 Polyclonal specifically detects S1P2/EDG-5/S1PR2 in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | S1P2/EDG-5/S1PR2 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | AGR16, EDG5, EDG-5, endothelial differentiation G-protein coupled receptor 5, endothelial differentiation, sphingolipid G-protein-coupled receptor, 5, Gpcr13, H218, LPB2, S1P receptor 2, S1P receptor Edg-5, S1P receptor EDG5, S1P2, sphingosine 1-phosphate receptor 2, sphingosine 1-phosphate receptor Edg-5, sphingosine-1-phosphate receptor 2 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human S1P2/EDG-5/S1PR2 (NP_004221.3). Peptide sequence VHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVLRPLQCWRPGV |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?