missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. S100B Antibody, Novus Biologicals™

S100B Antibody, Novus Biologicals™

Product Code. 18461981 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18461981 25 μL 25µL
18413071 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18461981 Supplier Novus Biologicals Supplier No. NBP18710225ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

S100B Polyclonal antibody specifically detects S100B in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen S100B
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias beta (neural), NEF, S100, S100 beta, S100 calcium binding protein B, S100 calcium-binding protein B, S100 calcium-binding protein, beta (neural), S-100 calcium-binding protein, beta chain, 10protein S100-B, S-100 protein beta chain, S-100 protein subunit beta, S100beta
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: LEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Alzheimers Research, Apoptosis, Biologically Active Proteins, Breast Cancer, Cancer, Cell Biology, Cellular Markers, Epigenetics, Hypoxia, Lipid and Metabolism, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Peroxisome Markers, Signal Transduction, Stem Cells
Primary or Secondary Primary
Gene ID (Entrez) 6285
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.