missing translation for 'onlineSavingsMsg'
Learn More

S100A6 Rabbit anti-Human, Mouse, Rat, Clone: 0J1Q5, Novus Biologicals™

Product Code. 18331656
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18331656 100 μg 100µL
18366993 20 μg 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18331656 Supplier Novus Biologicals Supplier No. NBP316191100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Monoclonal Antibody

S100A6 Monoclonal antibody specifically detects S100A6 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen S100A6
Applications Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 0J1Q5
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias 2A9, CABP, CACY5B10, calcyclin, Growth factor-inducible protein 2A9, MLN 4, PRAS100 calcium binding protein A6 (calcyclin), Prolactin receptor-associated protein, protein S100-A6, S100 calcium binding protein A6, S100 calcium-binding protein A6, S100 calcium-binding protein A6 (calcyclin)
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human S100A6 (P06703). MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research
Primary or Secondary Primary
Gene ID (Entrez) 6277
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.