missing translation for 'onlineSavingsMsg'
Learn More

S100A5 Antibody (5E1), Novus Biologicals™

Product Code. 18387329 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18387329 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18387329 Supplier Novus Biologicals Supplier No. H00006276M03

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

S100A5 Monoclonal antibody specifically detects S100A5 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen S100A5
Applications Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), Sandwich ELISA
Classification Monoclonal
Clone 5E1
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunohistochemistry 1:10 to 1:500, Immunohistochemistry-Paraffin 1:10 to 1:500, Sandwich ELISA 1:100 to 1:2000
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_002953
Gene Alias Protein S-100D, S100 calcium binding protein A5, S100 calcium-binding protein A5S100Dprotein S100-A5
Host Species Mouse
Immunogen S100A5 (NP_002953, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPAAWILWAHSHSELHTVMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEY
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 6276
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.