missing translation for 'onlineSavingsMsg'
Learn More
Learn More
S100A4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 4 publications
£234.00 - £460.00
Specifications
| Antigen | S100A4 |
|---|---|
| Dilution | Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500, KnockDown Validated |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18433021
|
Novus Biologicals
NBP1-89402-25ul |
25 μL |
£234.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18099223
|
Novus Biologicals
NBP1-89402 |
0.1 mL |
£460.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
S100A4 Polyclonal specifically detects S100A4 in Human, Mouse, Rat, Porcine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| S100A4 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| P26447 | |
| 6275 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| 12 kDa |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500, KnockDown Validated | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 18A2, Calvasculin, CAPLS100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, fibroblast-specific protein-1,42A, FSP1, leukemia multidrug resistance associated protein, malignant transformation suppression 1, Metastasin, MTS1, murine placental homolog), P9KA, PEL98, Placental calcium-binding protein, Protein Mts1, protein S100-A4, S100 calcium binding protein A4, S100 calcium-binding protein A4, S100 calcium-binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog) | |
| S100A4 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title