S100A11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Novus Biologicals NBP2-13270

Codice prodotto. 18155600

Descrizione

S100A11 Polyclonal specifically detects S100A11 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifica

• Antigen: S100A11
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: S100A11
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: SLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSF
• Quantity: 0.1 mL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 6282
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Concentration: 0.05mg/mL
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: calgizzarin, Metastatic lymph node gene 70 protein, MLN 70, MLN70, protein S100-A11, Protein S100-C, S100 calcium binding protein A11, S100 calcium-binding protein A11, S100 calcium-binding protein A11 (calgizzarin), S100CS100 calcium binding protein A11 (calgizzarin)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only