missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18325909

S100A11 Antibody (1B12), Novus Biologicals™

Product Code. 18325909 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18325909 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18325909 Supplier Novus Biologicals Supplier No. H00006282M17

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

S100A11 Monoclonal antibody specifically detects S100A11 in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen S100A11
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 1B12
Conjugate Unconjugated
Dilution Western Blot, ELISA, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. AAH14354
Gene Alias calgizzarin, Metastatic lymph node gene 70 protein, MLN 70, MLN70, protein S100-A11, Protein S100-C, S100 calcium binding protein A11, S100 calcium-binding protein A11, S100 calcium-binding protein A11 (calgizzarin), S100CS100 calcium binding protein A11 (calgizzarin)
Host Species Mouse
Immunogen S100A11 (AAH14354.1, 10 a.a. ~ 87 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGL
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 6282
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.