missing translation for 'onlineSavingsMsg'
Learn More

S100A10 Antibody, Novus Biologicals™

Product Code. 18403141 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18403141 25 μL 25µL
18431011 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18403141 Supplier Novus Biologicals Supplier No. NBP18937025ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

S100A10 Polyclonal antibody specifically detects S100A10 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDown
TRUSTED_SUSTAINABILITY

Specifications

Antigen S100A10
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDown
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunoprecipitation -Reported in scientific publication (PMID: 32427586), Immunohistochemistry-Paraffin 1:200 - 1:500, Knockdown Validated
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias annexin II ligand, calpactin I, light polypeptide, ANX2L, ANX2LG, CAL1LGP11,42C, Calpactin I light chain, Calpactin-1 light chain, Cellular ligand of annexin II, CLP11Ca[1], MGC111133, p10, p10 protein, p11, protein S100-A10, S100 calcium binding protein A10, S100 calcium binding protein A10 (annexin II ligand, calpactin I, lightpolypeptide (p11)), S100 calcium-binding protein A10, S100 calcium-binding protein A10 (annexin II ligand, calpactin I, lightpolypeptide (p11))
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKV
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cell Biology, Cytoskeleton Markers, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 6281
Target Species Human, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.