missing translation for 'onlineSavingsMsg'
Learn More

S100A1 Antibody (1D5), Novus Biologicals™

Product Code. 18372609 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18372609 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18372609 Supplier Novus Biologicals Supplier No. H00006271M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

S100A1 Monoclonal antibody specifically detects S100A1 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen S100A1
Applications Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), Sandwich ELISA
Classification Monoclonal
Clone 1D5
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. P23297
Gene Alias protein S100-A1, S100 alpha, S100 calcium binding protein A1, S100 calcium-binding protein A1S100, S-100 protein alpha chain, S-100 protein subunit alpha, S100 protein, alpha polypeptide, S100A, S100-alpha
Host Species Mouse
Immunogen S100A1 (NP_006262, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEY
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Breast Cancer, Cell Biology, Cellular Markers, Neuronal Cell Markers, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 6271
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.