missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RYR3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £483.00
Specifications
| Antigen | RYR3 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18677921
|
Novus Biologicals
NBP2-76559-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18288819
|
Novus Biologicals
NBP2-76559 |
100 μL |
£483.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RYR3 Polyclonal specifically detects RYR3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| RYR3 | |
| Polyclonal | |
| Rabbit | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
| 6263.0 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: TMDSPPCLKVTHKTFGTQNSNADMIYCRLSMPVECHSSFSHSPCLDSEAFQKRKQMQEILSHTTTQCYYAIRIFAGQ | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| Human | |
| brain ryanodine receptor-calcium release channel, brain-type ryanodine receptor, HBRR, ryanodine receptor 3, RYR-3 | |
| RYR3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title