missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Ryanodine Receptor 2 Antibody, Novus Biologicals™

Ryanodine Receptor 2 Antibody, Novus Biologicals™

Product Code. 18407051 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Conditionnement:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantity unitSize
18407051 25 μL 25µL
18216057 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18407051 Fournisseur Novus Biologicals Code fournisseur NBP19009125ul

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody has been used in 1 publication

Ryanodine Receptor 2 Polyclonal specifically detects Ryanodine Receptor 2 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry Free-Floating.
TRUSTED_SUSTAINABILITY

Spécification

Antigen Ryanodine Receptor 2
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Free Floating)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:500 - 1:1000, Immunohistochemistry Free-Floating -Reported in scientific literature (PMID:30483051).
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias arrhythmogenic right ventricular dysplasia 2, ARVC2, ARVD2, cardiac muscle ryanodine receptor-calcium release channel, Cardiac muscle-type ryanodine receptor, cardiac-type ryanodine receptor, hRYR-2, islet-type ryanodine receptor, kidney-type ryanodine receptor, ryanodine receptor 2, ryanodine receptor 2 (cardiac), RyR2, RYR-2, type 2 ryanodine receptor, VTSIP
Gene Symbols RYR2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QDEVRGDGEEGERKPLEAALPSEDLTDLKELTEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLMSNPVPMPEVQEKFQEQKAKEEEKEEKEETKSEPE
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6262
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.