missing translation for 'onlineSavingsMsg'
Learn More

RXR gamma/NR2B3 Antibody (6H1), Novus Biologicals™

Product Code. 18387389 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18387389 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18387389 Supplier Novus Biologicals Supplier No. H00006258M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

RXR gamma/NR2B3 Monoclonal antibody specifically detects RXR gamma/NR2B3 in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen RXR gamma/NR2B3
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 6H1
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_008848
Gene Alias NR2B3retinoid X receptor-gamma, Nuclear receptor subfamily 2 group B member 3, retinoic acid receptor RXR-gamma, Retinoid X receptor gamma, retinoid X receptor, gamma, RXRC
Host Species Mouse
Immunogen RXRG (NP_008848, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVGTPLNALGSPYRVITS
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 6258
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.