missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RXFP3/RLN3R1/SALPR Antibody, Novus Biologicals™

RXFP3/RLN3R1/SALPR Antibody, Novus Biologicals™

Product Code. 18422102 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
Unit Size:
25µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18422102 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18422102 Supplier Novus Biologicals Supplier No. NBP19196325ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

RXFP3/RLN3R1/SALPR Polyclonal specifically detects RXFP3/RLN3R1/SALPR in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen RXFP3/RLN3R1/SALPR
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias G protein-coupled receptor SALPR, GPCR135MGC141998, G-protein coupled receptor SALPR, relaxin 3 receptor 1, Relaxin family peptide receptor 3RLN3 receptor 1, relaxin/insulin-like family peptide receptor 3, relaxin-3 receptor 1, RLN3R1MGC142000, RXFPR3, SALPRG-protein coupled receptor GPCR135, somatostatin and angiotensin-like peptide receptor, Somatostatin- and angiotensin-like peptide receptor
Gene Symbols RXFP3
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MQMADAATIATMNKAAGGDKLAELFSLVPDLLEAANTSGNASLQLPDLWWELGLELPDG
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline GPCR
Primary or Secondary Primary
Gene ID (Entrez) 51289
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.