missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RUSC1 antisense RNA 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RUSC1 antisense RNA 1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RUSC1 antisense RNA 1 Polyclonal specifically detects RUSC1 antisense RNA 1 in Human samples. It is validated for Western Blot.Specifications
| RUSC1 antisense RNA 1 | |
| Polyclonal | |
| Rabbit | |
| Q66K80 | |
| 284618 | |
| Synthetic peptides corresponding to RUSC1 antisense RNA 1 The peptide sequence was selected from the middle region of RUSC1 antisense RNA 1 (50ug). Peptide sequence APLSCPAPRAQVHRSTPMGRALLTRVLLEPLRPWACPRLPRSPPGGAQSG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| chromosome 1 open reading frame 104, FLJ35976, hypothetical protein LOC284618, RP11-21N7.3 | |
| RUSC1-AS1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title