missing translation for 'onlineSavingsMsg'
Learn More

RUNX1T1/ETO Antibody, Novus Biologicals™

Product Code. 18337807 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18337807 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18337807 Supplier Novus Biologicals Supplier No. H00000862D01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

RUNX1T1/ETO Polyclonal antibody specifically detects RUNX1T1/ETO in Human samples. It is validated for Western Blot, Proximity Ligation Assay
TRUSTED_SUSTAINABILITY

Specifications

Antigen RUNX1T1/ETO
Applications Western Blot, Proximity Ligation Assay
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_004340.1
Gene Alias AML1T1protein CBFA2T1, CBFA2T1Cyclin-D-related protein, CDRMGC2796, core-binding factor, runt domain, alpha subunit 2, translocated to, 1, cyclinD-related, DKFZp564B213, Eight twenty one protein, ETOFLJ33145, MTG8acute myelogenous leukemia 1 translocation 1, cyclin-D related, Protein ETO, Protein MTG8, runt-related transcription factor 1, translocated to, 1 (cyclin D-related), Zinc finger MYND domain-containing protein 2, ZMYND2myeloid translocation gene on 8q22
Host Species Rabbit
Immunogen RUNX1T1 (NP_004340.1, 1 a.a. - 577 a.a.) full-length human protein. MPDRTEKHSTMPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIETTPR
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 862
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.