missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
RUFY1 Polyclonal specifically detects RUFY1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
Specifications
| Antigen | RUFY1 |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide |
| Gene Alias | La-binding protein 1, Rab4-interacting protein, RABIP4FYVE-finger protein EIP1, RUN and FYVE domain containing 1, RUN and FYVE domain-containing 1, RUN and FYVE domain-containing protein 1, ZFYVE12FLJ22251, Zinc finger FYVE domain-containing protein 12 |
| Gene Symbols | RUFY1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NLQMFHKAQNAESSLQQKNEAITSFEGKTNQVMSSMKQMEERLQHSERARQGAEERSHKLQQELGGRIGALQLQLSQLHEQCSSLEKEL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?