missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RSG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | RSG1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18263854
|
Novus Biologicals
NBP2-58973 |
100 μL |
£488.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18630229
|
Novus Biologicals
NBP2-58973-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RSG1 Polyclonal specifically detects RSG1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| RSG1 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| C1orf89, chromosome 1 open reading frame 89, MGC10731, miro domain-containing protein C1orf89, Rem/Rab-Similar GTPase 1, REM2 and RAB-like small GTPase 1, RP4-733M16.4 | |
| RSG1 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 79363 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VHHETTGIQTTVVFWPAKLQASSRVVMFRFEFWDCGESALKKFDHMLLACMENTDAFLFLFSFTDRASFEDLPGQLARIAGEAPGVVRMVIGS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title