RSAD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17433-100UL

Product Code. 18390107

Description

RSAD1 Polyclonal antibody specifically detects RSAD1 in Human samples. It is validated for Immunofluorescence

Specifications

• Antigen: RSAD1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: EC 1.3.99, EC 1.3.99.-, EC 1.3.99.22, FLJ11164, FLJ20975, Oxygen-independent coproporphyrinogen-III oxidase-like protein RSAD1, radical S-adenosyl methionine domain containing 1, radical S-adenosyl methionine domain-containing protein 1, mitochondrial
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DHLSLYQLSLERGTALFAQVQRGALPAPDPELAAEMYQRGRAVLREAGFHQYEVSNFARNGALSTHNWTYWQCGQYLGVGPGAHGRFMPQG
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55316
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG