missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RRP12 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£385.00 - £587.00
Specifications
| Antigen | RRP12 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18382323
|
Bio-Techne
NBP3-17764-25UL |
25 μg |
£385.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18323563
|
Bio-Techne
NBP3-17764-100UL |
100 μg |
£587.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RRP12 Polyclonal antibody specifically detects RRP12 in Human samples. It is validated for Western Blot, ImmunofluorescenceSpecifications
| RRP12 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human | |
| FLJ20231, KIAA0690DKFZp762P1116, ribosomal RNA processing 12 homolog (S. cerevisiae), RRP12-like protein | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RTYLTITDTQLVNSLLEKASEKVLDPASSDFTRLSVLDLVVALAPCADEAAISKLYSTIRPYLESKAHGVQKKAYRVLEEVCASPQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, 40% glycerol | |
| 23223 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title