missing translation for 'onlineSavingsMsg'
Learn More

RRN3 Antibody, Novus Biologicals™

Product Code. 18382389 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18382389 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18382389 Supplier Novus Biologicals Supplier No. H00054700B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Polyclonal Antibody

RRN3 Polyclonal antibody specifically detects RRN3 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen RRN3
Applications Western Blot, Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500, Immunocytochemistry/ Immunofluorescence
Formulation PBS (pH 7.4)
Gene Accession No. ENSP00000219758
Gene Alias DKFZp566E104, RNA polymerase I-specific transcription initiation factor RRN3, RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae), RRN3 RNA polymerase I transcription factor homolog (yeast), TIF-IA, TIFIAMGC104238, Transcription initiation factor IA, transcription initiation factor TIF-IA
Host Species Mouse
Immunogen RRN3 (ENSP00000219758, 1 a.a. - 106 a.a.) full-length human protein. MRALENDFFNSPPRKTVRFGGTVTEVLLKYKKGETNDFELLKNQLLDPDIKDDQIINWLLEFRSSVMYLTKDFEQLISIILRLPWLNRSQTVVEEYLAFLGNLVSA
Purification Method Protein A purified
Quantity 0.05 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54700
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.