missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RRM2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38129-100ul
This item is not returnable.
View return policy
Description
RRM2 Polyclonal antibody specifically detects RRM2 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Specifications
| RRM2 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| EC 1.17.4.1, R2, ribonucleoside-diphosphate reductase subunit M2, ribonucleotide reductase M2, ribonucleotide reductase M2 polypeptide, Ribonucleotide reductase small chain, Ribonucleotide reductase small subunit, RR2, RR2M | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-389 of human RRM2 (NP_001025.1).,, Sequence:, MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDE | |
| 100 μL | |
| Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers | |
| 6241 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction