missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RPS6KC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £470.00
Specifications
| Antigen | RPS6KC1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18221352
|
Novus Biologicals
NBP2-54999 |
100 μL |
£470.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18677206
|
Novus Biologicals
NBP2-54999-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RPS6KC1 Polyclonal specifically detects RPS6KC1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| RPS6KC1 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 26750 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QGLGVVESAVTANNTEESLFRICSPLSGANEYIASTDTLKTEEVLLFTDQTDDLAKEEPTSLFQRDSETKGESGLVLEGDKEIHQIFEDLDKKLALASRFYIPEGCIQRWA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| EC 2.7.11.1, humS6PKh1, ribosomal protein S6 kinase delta-1, ribosomal protein S6 kinase, 52kD, polypeptide 1,52 kDa ribosomal protein S6 kinase, ribosomal protein S6 kinase, 52kDa, polypeptide 1, Ribosomal S6 kinase-like protein with two PSK domains 118 kDa protein, RPK118, S6K-delta-1, SPHK1-binding protein | |
| RPS6KC1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title