missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Rpn2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £470.00
Specifications
| Antigen | Rpn2 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18110209
|
Novus Biologicals
NBP2-38323 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18665795
|
Novus Biologicals
NBP2-38323-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Rpn2 Polyclonal specifically detects Rpn2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Rpn2 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Neuroscience, Ubiquitin Proteasome Pathway | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 26S proteasome non-ATPase regulatory subunit 1, 26S proteasome regulatory subunit RPN2, 26S proteasome regulatory subunit S1, 26S proteasome subunit p112, MGC133040, MGC133041, P112, proteasome (prosome, macropain) 26S subunit, non-ATPase, 1, Rpn2, S1 | |
| PSMD1 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q99460 | |
| 5707 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title