missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RPLP0 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£343.00 - £557.00
Specifications
| Antigen | RPLP0 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18376714
|
Novus Biologicals
NBP3-17763-25UL |
25 μg |
£343.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18355184
|
Novus Biologicals
NBP3-17763-100UL |
100 μg |
£557.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RPLP0 Polyclonal antibody specifically detects RPLP0 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| RPLP0 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| 60S acidic ribosomal protein P0, 60S ribosomal protein L10E, acidic ribosomal phosphoprotein P0, L10E, MGC111226, MGC88175, P0, PRLP0, ribosomal protein, large, P0, RPP0 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGY | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, 40% glycerol | |
| 6175 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title