missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
RPL7 Monoclonal antibody specifically detects RPL7 in Human samples. It is validated for ELISA, Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | RPL7 |
| Applications | ELISA, Immunocytochemistry |
| Classification | Monoclonal |
| Clone | 2E10 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_000962 |
| Gene Alias | humL7-1,60S ribosomal protein L7, MGC117326, ribosomal protein L7 |
| Host Species | Mouse |
| Immunogen | RPL7 (NP_000962.2, 158 a.a. ~ 248 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRMN |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?