missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RPL7 Antibody (2E10), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00006129-M06
This item is not returnable.
View return policy
Description
RPL7 Monoclonal antibody specifically detects RPL7 in Human samples. It is validated for ELISA, Immunocytochemistry/ Immunofluorescence
Specifications
| RPL7 | |
| Monoclonal | |
| Unconjugated | |
| NP_000962 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| ELISA, Immunocytochemistry | |
| 2E10 | |
| In 1x PBS, pH 7.4 | |
| humL7-1,60S ribosomal protein L7, MGC117326, ribosomal protein L7 | |
| RPL7 (NP_000962.2, 158 a.a. ~ 248 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRMN | |
| 0.1 mg | |
| Immune System Diseases, Immunology | |
| 6129 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction