missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RPL36A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
£328.00 - £484.00
Specifications
| Antigen | RPL36A |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18108778
|
Novus Biologicals
NBP2-38036 |
0.1 mL |
£484.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18676515
|
Novus Biologicals
NBP2-38036-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RPL36A Polyclonal specifically detects RPL36A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| RPL36A | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 6173 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MIAPTDSHEEVRSGTSYILPFASRFLSFRA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 60S ribosomal protein L36a, Cell growth-inhibiting gene 15 protein, Cell migration-inducing gene 6 protein, dJ164F3.3 (ribosomal protein L44), L44L, L44-like ribosomal protein, MGC72020, MIG6,60S ribosomal protein L44, ribosomal protein L36a, ribosomal protein L44, RPL36AL, RPL44 | |
| RPL36A | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title