missing translation for 'onlineSavingsMsg'
Learn More

RPL24/RLP24 Antibody, Novus Biologicals™

Product Code. 30232695 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30232695 100 μL 100µL
30227121 20 μL 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30232695 Supplier Novus Biologicals Supplier No. NBP335776100ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

RPL24/RLP24 Polyclonal antibody specifically detects RPL24/RLP24 in Human,Mouse samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen RPL24/RLP24
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, ELISA
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias C15orf15, HRP-L30-iso, L30, RLP24, RPL24, RPL24L, RSL24D1 ribosomal L24 domain containing 1, TVAS3
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 10-80 of human RPL24/RLP24 (NP_057388.1).,, Sequence:, SGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIK
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 51187
Target Species Human, Mouse
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.