missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RPL24/RLP24 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35776-20ul
This item is not returnable.
View return policy
Description
RPL24/RLP24 Polyclonal antibody specifically detects RPL24/RLP24 in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
| RPL24/RLP24 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| C15orf15, HRP-L30-iso, L30, RLP24, RPL24, RPL24L, RSL24D1 ribosomal L24 domain containing 1, TVAS3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 10-80 of human RPL24/RLP24 (NP_057388.1).,, Sequence:, SGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIK | |
| 20 μL | |
| Stem Cell Markers | |
| 51187 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction