missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RPL13A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | RPL13A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RPL13A Polyclonal specifically detects RPL13A in Human samples. It is validated for Western Blot.Specifications
| RPL13A | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| 60S ribosomal protein L13a, ribosomal protein L13a, tissue specific transplantation antigen 1,23 kDa highly basic protein, TSTA1 | |
| RPL13A | |
| IgG | |
| 22 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P40429 | |
| 23521 | |
| Synthetic peptides corresponding to RPL13A(ribosomal protein L13a) The peptide sequence was selected from the middle region of RPL13A. Peptide sequence HEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKY. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title